PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10026611
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family MYB
Protein Properties Length: 389aa    MW: 42953.4 Da    PI: 8.5755
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10026611genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding50.74.2e-1678123147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg W + Ed +l+++v ++G+ +W++Ia+++  gR++k+c++rw++ 
      Lus10026611  78 RGHWRPAEDSKLKELVSLYGPQNWNLIAEKLE-GRSGKSCRLRWFNQ 123
                      899*****************************.***********996 PP

2Myb_DNA-binding538e-17130173146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      r +++++E+e+l +a++ +G++ W+ Iar ++ gRt++ +k++w+ 
      Lus10026611 130 RRAFSEDEEERLMQAHRVYGNK-WAMIARLFP-GRTDNAVKNHWHV 173
                      678*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.99673124IPR017930Myb domain
SMARTSM007174.7E-1477126IPR001005SANT/Myb domain
SuperFamilySSF466891.31E-2778171IPR009057Homeodomain-like
PfamPF002491.4E-1578123IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.7E-2579131IPR009057Homeodomain-like
CDDcd001671.21E-1281122No hitNo description
PROSITE profilePS5129426.222125179IPR017930Myb domain
SMARTSM007172.0E-13129177IPR001005SANT/Myb domain
PfamPF002491.3E-13130172IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.2E-20132178IPR009057Homeodomain-like
CDDcd001671.56E-10132172No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 389 aa     Download sequence    Send to blast
MKPWPERTEA HHTSSCSSPM VAMVNADIAS LTLSSASPAS LFPSDCTTTT TTSNEEDNKI  60
KETTLVLTEC GQSKLCARGH WRPAEDSKLK ELVSLYGPQN WNLIAEKLEG RSGKSCRLRW  120
FNQLDPRINR RAFSEDEEER LMQAHRVYGN KWAMIARLFP GRTDNAVKNH WHVIMARKYR  180
EQSSAYSRRK LSNSNGNGNG NGGSCSNNSG GDSGSNNSYN NNTYSSSSPP CSRMDEMMMM  240
IPTASLFHQN QVGGDQQHHF INGGRGIIKG GGGFVVPHQQ TTFDFFPGGK SSSNEMMIMG  300
MLSQSRSCWD HHQYHQSNGN NNNNNLAIQQ SNYSLNQRIH HPTHHRMVIS SSSSFGDHQE  360
RSSSSSAVVS SSSNNPPPFI DFLGVGAT*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-33781787107B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015895032.11e-101PREDICTED: transcriptional activator Myb-like
TrEMBLA0A0B0NX301e-93A0A0B0NX30_G
TrEMBLD9ZJ603e-94D9ZJ60_MALDO; MYB domain class transcription factor
STRINGVIT_01s0026g02600.t011e-91(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF23034243
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69560.15e-76myb domain protein 105